Zockerheim.de valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot / ✔
BingBot / ✔
BaiduSpider / ✔
YandexBot / ✔
Meta Tags
Title Zockerheim.de - PC, PS4, Xbox One und Switch News
Description Wir von Zockerheim.de berichten täglich über die wichtigen Neuigkeiten rund um den PC und den Konsolen aus dem Hause Sony, Nintendo und Microsoft. Trailer und Tests zu den aktuellen Games gibt es ebenfalls.
Keywords N/A
Server Information
WebSite zockerheim favicon www.zockerheim.de
Host IP 5.175.14.15
Location North Rhine-Westphalia, Germany
Related Websites
Site Rank
pixelcritics.com #4,367,942
gamenewz.de #3,276,546
insidexbox.de #2,523,473
gamodrome.de #1,769,125
game7.de #2,821,069
More to Explore
4taraftarium24.com
lookerideas.net
adducation.info
skyscrapmetal.com.au
itau-unibanco.com
ausablevalleygrangefarmersmarkets.com
cooltech.in
themushroomcloud.co.nz
expert-saltele.ro
drimus.ro
dorfwerkstatt-heppendorf.de
drupal.com.au
Zockerheim.de Valuation
US$4,132
Last updated: Feb 16, 2020

Zockerheim.de has global traffic rank of 12,200,868. Zockerheim.de has an estimated worth of US$ 4,132, based on its estimated Ads revenue. Zockerheim.de receives approximately 251 unique visitors each day. Its web server is located in North Rhine-Westphalia, Germany, with IP address 5.175.14.15. According to SiteAdvisor, zockerheim.de is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$4,132
Daily Ads Revenue US$2
Monthly Ads Revenue US$67
Yearly Ads Revenue US$826
Daily Unique Visitors 251
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 12,200,868
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
zockerheim.de A 21599 IP: 5.175.14.15
zockerheim.de AAAA 21599 IPv6: 2a01:488:42:1000:50ed:820f:2b:39c4
zockerheim.de MX 21599 Priority: 50
Target: mx0.zockerheim.de.
zockerheim.de NS 21599 Target: ns2.hans.hosteurope.de.
zockerheim.de NS 21599 Target: ns1.hans.hosteurope.de.
zockerheim.de SOA 2559 MNAME: ns1.hans.hosteurope.de.
RNAME: hostmaster.zockerheim.de.
Serial: 2019032517
Refresh: 16384
Retry: 2048
Expire: 1048576
Minimum TTL: 2560
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Sun, 16 Feb 2020 01:48:45 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 230
Connection: keep-alive
Server: Apache
Location: https://zockerheim.de/
Cache-Control: max-age=60
Expires: Sun, 16 Feb 2020 01:49:45 GMT

HTTP/1.1 301 Moved Permanently
Date: Sun, 16 Feb 2020 01:48:46 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 0
Connection: keep-alive
Server: Apache
X-Redirect-By: WordPress
Location: https://www.zockerheim.de/
Cache-Control: max-age=60
Expires: Sun, 16 Feb 2020 01:49:45 GMT
Vary: User-Agent

HTTP/1.1 200 OK
Date: Sun, 16 Feb 2020 01:48:47 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Apache
Link: <https://www.zockerheim.de/wp-json/>; rel="https://api.w.org/"
Link: <https://www.zockerheim.de/>; rel=shortlink
Vary: Accept-Encoding,User-Agent
Cache-Control: max-age=60
Expires: Sun, 16 Feb 2020 01:49:46 GMT
Zockerheim.de Whois Information
Domain: zockerheim.de
Nserver: ns1.hans.hosteurope.de
Nserver: ns2.hans.hosteurope.de
Status: connect
Changed: 2018-05-22T20:52:19+02:00

Copyright © 2019 SiteIndices